HPA023399

ARFGEF1 antibody from Sigma-Aldrich
ARFGEP1, BIG1, DKFZP434L057, p200
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023399
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023399, RRID:AB_1844981
Product name
Anti-ARFGEF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023399
Antibody type
Polyclonal
Antigen
Brefeldin A-inhibited guanine nucleotide-exchange protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGE
GTTINASADGNIGTIEDGSDSENIQANGIPGTPIS
VAYTPSLPDDRLSVSSNDTQESGNSSGPSPGAKF
Storage
-20C
Provider Type Product Number
- No reagents -