HPA002238

CCT5 antibody from Sigma-Aldrich
KIAA0098
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002238
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002238, RRID:AB_1078427
Product name
Anti-CCT5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002238
Antibody type
Polyclonal
Antigen
T-complex protein 1 subunit epsilon recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVD
IKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAV
LTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGV
IVDKDFSHPQM
Storage
-20C
Provider Type Product Number
- No reagents -