HPA005958

CCT5 antibody from Sigma-Aldrich
KIAA0098
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005958
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005958, RRID:AB_1846209
Product name
Anti-CCT5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005958
Antibody type
Polyclonal
Antigen
T-complex protein 1 subunit epsilon recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALQKYEKEKFEEMIQQIKETGANLAICQWGFDDEA
NHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRF
SELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNS
RAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRD
NRVVYGGGA
Storage
-20C
Provider Type Product Number
- No reagents -