Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008419 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-BUB1B
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCK
IEPSINHILSTRKPGKEEGDPLQRVQSHQQASEEK
KEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKEQ
REAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQE
RTGD- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013;10(4):315-323
Nature Methods 2013;10(4):315-323
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E
Journal of Proteomics 2012;75(7):2236-2251
Journal of Proteomics 2012;75(7):2236-2251
No comments: Submit comment
No validations: Submit validation data