HPA015247

GPRC5B antibody from Sigma-Aldrich
RAIG-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015247
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015247, RRID:AB_1849323
Product name
Anti-GPRC5B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015247
Antibody type
Polyclonal
Antigen
G-protein coupled receptor family C group 5 member B precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQL
PRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSG
SLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAP
Storage
-20C
Provider Type Product Number
- No reagents -