HPA019094

PRDM14 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019094
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019094, RRID:AB_1855686
Product name
Anti-PRDM14 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019094
Antibody type
Polyclonal
Antigen
PR domain zinc finger protein 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ADASLLPEGLRTSQLLPCSPSKQSEDGPKPSNQEG
KSPARFQFTEEDLHFVLYGVTPSLEHPASLHHAIS
GLLVPPDSSGSDSLPQTLDKDSLQLPEGLCLMQTV
FGEVP
Storage
-20C
Provider Type Product Number
- No reagents -