Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91448 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91448, RRID:AB_2732102
- Product name
- Anti-ITGA5
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
DQPQKEEDLGPAVHHVYELINQGPSSISQGVLELS
CPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELD
PEGSLHHQQKREAPSRSSASSGPQILKCPEAECFR
LRCELGPLHQQESQSLQLHFRVWA- Epitope
- Binds to an epitope located within the peptide sequence LRCELGPLHQQESQS as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL6945
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human placenta and testis tissues using AMAb91448 antibody. Corresponding ITGA5 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong apical membrane positivity in trophoblastic cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows moderate to strong membranous positivity in smooth muscle cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows moderate positivity in liver sinusoids.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected.