HPA002642

ITGA5 antibody from Sigma-Aldrich
CD49e, FNRA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002642
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002642, RRID:AB_1078469
Product name
Anti-ITGA5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002642
Antibody type
Polyclonal
Antigen
Integrin alpha-5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DQPQKEEDLGPAVHHVYELINQGPSSISQGVLELS
CPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELD
PEGSLHHQQKREAPSRSSASSGPQILKCPEAECFR
LRCELGPLHQQESQSLQLHFRVWA
Storage
-20C
Provider Type Product Number
- No reagents -