HPA004943

SLCO1B3 antibody from Sigma-Aldrich
OATP1B3, OATP8, SLC21A8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004943
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004943, RRID:AB_1854758
Product name
Anti-SLCO1B3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004943
Antibody type
Polyclonal
Antigen
Solute carrier organic anion transporter family member 1B3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGT
DSKTCNLDMQDNAAA
Storage
-20C
Provider Type Product Number
- No reagents -