HPA027006

SRD5A3 antibody from Atlas Antibodies
FLJ13352, SRD5A2L, SRD5A2L1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027006
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027006, RRID:AB_1857469
Product name
Anti-SRD5A3
Provider product page
Atlas Antibodies - HPA027006
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSS
PNYL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -