HPA027006

SRD5A3 antibody from Sigma-Aldrich
FLJ13352, SRD5A2L, SRD5A2L1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027006
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027006, RRID:AB_1857469
Product name
Anti-SRD5A2L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027006
Antibody type
Polyclonal
Antigen
3-oxo-5-alpha-steroid 4-dehydrogenase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSS
PNYL
Storage
-20C
Provider Type Product Number
- No reagents -