Antibody data

Product number
H00001428-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001428-M03, RRID:AB_565616
Product name
CRYM monoclonal antibody (M03), clone 6B3
Provider product page
Abnova Corporation - H00001428-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CRYM.
Antigen sequence
EWVKPGAHINAVGASRPDWRELDDELMKEAVLYVD
SQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHC
EKTTVFKSLGMAVEDTVAAKLIYDSWSSGK
Isotype
IgG
Antibody clone number
6B3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -