Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001428-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001428-M03, RRID:AB_565616
- Product name
- CRYM monoclonal antibody (M03), clone 6B3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CRYM.
- Antigen sequence
EWVKPGAHINAVGASRPDWRELDDELMKEAVLYVD
SQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHC
EKTTVFKSLGMAVEDTVAAKLIYDSWSSGK- Isotype
- IgG
- Antibody clone number
- 6B3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The FSHD atrophic myotube phenotype is caused by DUX4 expression.
Proteomic analysis illuminates a novel structural definition of the claustrum and insula.
Abnormal expression of mu-crystallin in facioscapulohumeral muscular dystrophy.
Vanderplanck C, Ansseau E, Charron S, Stricwant N, Tassin A, Laoudj-Chenivesse D, Wilton SD, Coppée F, Belayew A
PloS one 2011;6(10):e26820
PloS one 2011;6(10):e26820
Proteomic analysis illuminates a novel structural definition of the claustrum and insula.
Mathur BN, Caprioli RM, Deutch AY
Cerebral cortex (New York, N.Y. : 1991) 2009 Oct;19(10):2372-9
Cerebral cortex (New York, N.Y. : 1991) 2009 Oct;19(10):2372-9
Abnormal expression of mu-crystallin in facioscapulohumeral muscular dystrophy.
Reed PW, Corse AM, Porter NC, Flanigan KM, Bloch RJ
Experimental neurology 2007 Jun;205(2):583-6
Experimental neurology 2007 Jun;205(2):583-6
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CRYM monoclonal antibody (M03), clone 6B3 Western Blot analysis of CRYM expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CRYM expression in transfected 293T cell line by CRYM monoclonal antibody (M03), clone 6B3.Lane 1: CRYM transfected lysate(33.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CRYM is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of CRYM transfected lysate using anti-CRYM monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CRYM MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CRYM on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol