HPA019086

CRYM antibody from Sigma-Aldrich
DFNA40
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019086
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019086, RRID:AB_1847260
Product name
Anti-CRYM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019086
Antibody type
Polyclonal
Antigen
Mu-crystallin homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAE
LGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLI
YDSWSSGK
Storage
-20C
Provider Type Product Number
- No reagents -