Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 75-297 - Provider product page

- Provider
- UC Davis/NIH NeuroMab Facility
- Proper citation
- UC Davis/NIH NeuroMab Facility Cat#75-297, RRID:AB_2315930
- Product name
- anti-SUR2B
- Antibody type
- Monoclonal
- Antigen
- Recombinant protein
- Reactivity
- Human, Mouse, Rat
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
amino acids 1503-1545 (VHTILTADLVIV
MKRGNILEYDTPESLLAQEDGVFASFVRADM, cy
toplasmic C-terminus) of rat SUR2B- Isotype
- IgG
- Antibody clone number
- N323A/51
- Vial size
- 100 µl
- Concentration
- 1mg/ml
- Storage
- Antibodies contain 10mm azide. Store at 4°C or aliquot and store at -20°C. Avoid repeated free-thaw cycles.
No comments: Submit comment
No validations: Submit validation data