HPA007279

ABCC9 antibody from Sigma-Aldrich
CMD1O, SUR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007279
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007279, RRID:AB_1844435
Product name
Anti-ABCC9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007279
Antibody type
Polyclonal
Antigen
ATP-binding cassette transporter sub-family C member 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QKLNEFLLSDEIGDDSWRTGESSLPFESCKKHTGV
QPKTINRKQPGRYHLDSYEQSTRRLRPAETEDIAI
KVTNGYFSWGSGLATLSNIDIRIPTGQLTMIVGQV
GCGKSSLLLAILGEMQTLEGKVHWSNVNESEP
Storage
-20C
Provider Type Product Number
- No reagents -