HPA024432

TAX1BP1 antibody from Sigma-Aldrich
CALCOCO3, TXBP151
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024432
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024432, RRID:AB_1857783
Product name
Anti-TAX1BP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024432
Antibody type
Polyclonal
Antigen
Tax1-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ADAVAELKLNAMKKDQDKTDTLEHELRREVEDLKL
RLQMAADHYKEKFKECQRLQKQINKLSDQSANNNN
VFTKKTGNQQKVNDASVNTDPATSASTVDVKPSPS
AAEADFDIVTKGQVCEMTKEIADKTEKYNK
Storage
-20C
Provider Type Product Number
- No reagents -