Antibody data

Product number
H00001327-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001327-M08, RRID:AB_1204168
Product name
COX4I1 monoclonal antibody (M08), clone 4A10
Provider product page
Abnova Corporation - H00001327-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant COX4I1.
Antigen sequence
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSL
PAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASW
SSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVG
GAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAK
QTKRMLDMKVNPIQGLASKWDYEKNEWKK
Isotype
IgG
Antibody clone number
4A10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -