HPA002485

COX4I1 antibody from Sigma-Aldrich
COX4, COX4-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002485
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002485, RRID:AB_1078559
Product name
Anti-COX4I1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002485
Antibody type
Polyclonal
Antigen
Cytochrome c oxidase subunit 4 isoform 1, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLP
AYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWS
SLSMDEKVELYRIKFKESFAEMNRGSNEWKT
Storage
-20C
Provider Type Product Number
- No reagents -