HPA027175

MASTL antibody from Sigma-Aldrich
FLJ14813, Gwl, THC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027175
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027175, RRID:AB_1853591
Product name
Anti-MASTL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027175
Antibody type
Polyclonal
Antigen
Microtubule-associated serine/threonine-protein kinase-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSQLGFHQSNQWAVDSGGISEEHLGKRSLKRNFEL
VDSSPCKKIIQNKKTCVEYKHNEMTNCYTNQNTGL
TVEVQDLKLSVHKSQQNDCANKEN
Storage
-20C
Provider Type Product Number
- No reagents -