Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406172 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1) (Isoform 48) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-OAS1 antibody: synthetic peptide directed towards the middle region of human OAS1
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
RRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQE
AEAWL NYPCFKNWDG- Vial size
- 50 µg
Submitted references Pattern recognition receptor-initiated innate antiviral response in mouse adipose cells.
RIG-I-like receptors mediate innate antiviral response in mouse testis.
Molecular study of the genus Astraeus.
Yu L, Yan K, Liu P, Li N, Liu Z, Zhu W, Chen Y, Han D
Immunology and cell biology 2014 Feb;92(2):105-15
Immunology and cell biology 2014 Feb;92(2):105-15
RIG-I-like receptors mediate innate antiviral response in mouse testis.
Zhu W, Chen Q, Yan K, Liu Z, Li N, Zhang X, Yu L, Chen Y, Han D
Molecular endocrinology (Baltimore, Md.) 2013 Sep;27(9):1455-67
Molecular endocrinology (Baltimore, Md.) 2013 Sep;27(9):1455-67
Molecular study of the genus Astraeus.
Phosri C, MartÃn MP, Sihanonth P, Whalley AJ, Watling R
Mycological research 2007 Mar;111(Pt 3):275-86
Mycological research 2007 Mar;111(Pt 3):275-86
No comments: Submit comment
No validations: Submit validation data