HPA003657

OAS1 antibody from Sigma-Aldrich
IFI-4, OIAS, OIASI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003657
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003657, RRID:AB_1854747
Product name
Anti-OAS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003657
Antibody type
Polyclonal
Antigen
2'-5'-oligoadenylate synthetase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERA
FSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDV
LPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEG
EFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNC
KK
Storage
-20C
Provider Type Product Number
- No reagents -