HPA018679

RASGRF2 antibody from Sigma-Aldrich
GRF2, Ras-GRF2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018679
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018679, RRID:AB_1856089
Product name
Anti-RASGRF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018679
Antibody type
Polyclonal
Antigen
Ras-specific guanine nucleotide-releasing factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRT
SSPVRARKLSLTSPLNSKIGALDLTTSSSPTTTTQ
SPAASPPPHTGQIPLDLSRGLSSPEQSPGTVEENV
D
Storage
-20C
Provider Type Product Number
- No reagents -