Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311756 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tripartite Motif Containing 22 (TRIM22) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TRIM22 antibody: synthetic peptide directed towards the N terminal of human TRIM22
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
LANIVERVKEVKMSPQEGQKRDVCEHHGKKLQIFC
KEDGK VICWVCELSQ- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Regulation of the interferon-inducible p53 target gene TRIM22 (Staf50) in human T lymphocyte activation.
Obad S, Olofsson T, Mechti N, Gullberg U, Drott K
Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 2007 Oct;27(10):857-64
Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 2007 Oct;27(10):857-64
No comments: Submit comment
No validations: Submit validation data