Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405171 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tripartite Motif Containing 22 (TRIM22) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TRIM22 antibody: synthetic peptide directed towards the middle region of human TRIM22
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
VDVSGKIAWILGVHSKISSLNKRKSSGFAFDPSVN
YSKVY SRYRPQYGYW- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Regulation of the interferon-inducible p53 target gene TRIM22 (Staf50) in human T lymphocyte activation.
Obad S, Olofsson T, Mechti N, Gullberg U, Drott K
Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 2007 Oct;27(10):857-64
Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 2007 Oct;27(10):857-64
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting