HPA003575

TRIM22 antibody from Sigma-Aldrich
GPSTAF50, RNF94, STAF50
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003575
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003575, RRID:AB_1080378
Product name
Anti-TRIM22 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003575
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 22 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQE
RTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQ
KLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQ
RRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKK
LKSVFRV
Storage
-20C
Provider Type Product Number
- No reagents -