HPA051519

antibody from Atlas Antibodies

Targeting: ADAR ADAR1, G1P1, IFI4

Antibody data

Submit

Validation data

Product number: HPA051519 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA051519, RRID:AB_2681520
Product name: Anti-ADAR
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ALLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVT RDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGK TKETSVNWCLADGYDLEILDGTRGTVDGPRNELSR VSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAAR DY
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ADAR protein structure - HPA051519 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, kidney and liver using Anti-ADAR antibody HPA051519 (A) shows similar protein distribution across tissues to independent antibody HPA003890 (B).
Antibody #2 product nr: HPA003890
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-ADAR antibody HPA051519.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-ADAR antibody HPA051519.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-ADAR antibody HPA051519.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-ADAR antibody HPA051519.
Sample type: HUMAN