Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90535 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90535, RRID:AB_2665578
- Product name
- Anti-ADAR
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
SDNQPEGMISESLDNLESMMPNKVRKIGELVRYLN
TNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFV
YQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIG
ENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEA- Isotype
- IgG
- Antibody clone number
- CL0176
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Gene amplification-associated overexpression of the RNA editing enzyme ADAR1 enhances human lung tumorigenesis.
Anadón C, Guil S, Simó-Riudalbas L, Moutinho C, Setien F, Martínez-Cardús A, Moran S, Villanueva A, Calaf M, Vidal A, Lazo PA, Zondervan I, Savola S, Kohno T, Yokota J, Ribas de Pouplana L, Esteller M
Oncogene 2016 Aug 18;35(33):4407-13
Oncogene 2016 Aug 18;35(33):4407-13
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of A549 cells using the Anti-ADAR monoclonal antibody, showing specific staining in the nucleoplasm and nucleoli in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows nuclear positivity.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows nuclear positivity.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows nuclear positivity.