HPA003890

ADAR antibody from Sigma-Aldrich
ADAR1, G1P1, IFI4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003890
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003890, RRID:AB_1078103
Product name
Anti-ADAR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003890
Antibody type
Polyclonal
Antigen
Double-stranded RNA-specific adenosine deaminase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SDNQPEGMISESLDNLESMMPNKVRKIGELVRYLN
TNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFV
YQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIG
ENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEA
Storage
-20C
Provider Type Product Number
- No reagents -