Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN148547 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interleukin 21 Receptor (IL21R) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide: CILEMWNLHPSTLTLTWQDQYEELKDEATS, corresponding to N-term amino acids 35-65 of Human IL21 Receptor.
- Description
- Immunogen affinity purified
- Reactivity
- Human
- Host
- Goat
- Isotype
- IgG
- Vial size
- 50 μg
- Concentration
- 1 mg/ml
- Storage
- -20°C
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry