ABIN342773

antibody from antibodies-online

Targeting: IL21R CD360

ELISA

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN342773 - Provider product page
Provider: antibodies-online
Product name: anti-Interleukin 21 Receptor (IL21R) (N-Term) antibody
Antibody type: Polyclonal
Antigen: Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to 35-65 residues of N-terminus of human IL-21 receptor.
Description: Immunoaffinity Chromatography
Reactivity: Human
Host: Goat
Epitope: N-Term
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at -20°C. Aliquot to avoid freeze/thaw cycles.
Handling: Aliquot to Avoid freeze/thaw cycles.

IL21R protein structure - ABIN342773 shown in red.