HPA021152

PDP1 antibody from Sigma-Aldrich
PDH, PDP, PPM2A, PPM2C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021152
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021152, RRID:AB_1855635
Product name
Anti-PPM2C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021152
Antibody type
Polyclonal
Antigen
No description available in Ensembl
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QDKFLVLATDGLWETMHRQDVVRIVGEYLTGMHHQ
QPIAVGGYKVTLGQMHGLLTERRTKMSSVFEDQNA
ATHLIRHAVGNNEFGT
Storage
-20C
Provider Type Product Number
- No reagents -