HPA019081

antibody from Atlas Antibodies

Targeting: PDP1 PDH, PDP, PPM2A, PPM2C

Antibody data

Submit

Validation data

Product number: HPA019081 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA019081, RRID:AB_1855633
Product name: Anti-PDP1
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: YIAVSLLPHETLLEIENAVESGRALLPILQWHKHP NDYFSKEASKLYFNSLRTYWQELIDLNTGESTDID VKEALINAFKRLDNDISLEAQVGDPNSFLNYLVLR VAFSGATACVAHVD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PDP1 protein structure - HPA019081 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-PDP1 antibody. Corresponding PDP1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Orthogonal method: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Western blot analysis using Anti-PDP1 antibody HPA019081 (A) shows similar pattern to independent antibody HPA021152 (B).
Antibody #2 product nr: HPA021152
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.