Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023616 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023616, RRID:AB_1845895
- Product name
- Anti-CDH17
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQE
GDIYVTQPLDREEKDAYVFYAVAKDEYGKPLSYPL
EIHVKVK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references SATB2 in Combination With Cytokeratin 20 Identifies Over 95% of all Colorectal Carcinomas
Magnusson K, de Wit M, Brennan D, Johnson L, McGee S, Lundberg E, Naicker K, Klinger R, Kampf C, Asplund A, Wester K, Gry M, Bjartell A, Gallagher W, Rexhepaj E, Kilpinen S, Kallioniemi O, Belt E, Goos J, Meijer G, Birgisson H, Glimelius B, Borrebaeck C, Navani S, Uhlén M, OʼConnor D, Jirström K, Pontén F
The American Journal of Surgical Pathology 2011 ;35(7):937-948
The American Journal of Surgical Pathology 2011 ;35(7):937-948
No comments: Submit comment
Supportive validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines Caco-2 and A-431 using Anti-CDH17 antibody. Corresponding CDH17 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and CDH17 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418246).
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human duodenum and liver tissues using Anti-CDH17 antibody. Corresponding CDH17 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human colon, duodenum, kidney and liver using Anti-CDH17 antibody HPA023616 (A) shows similar protein distribution across tissues to independent antibody HPA023614 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-CDH17 antibody HPA023616.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-CDH17 antibody HPA023616.
- Sample type
- HUMAN