HPA026556

CDH17 antibody from Atlas Antibodies
cadherin, HPT-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026556
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026556, RRID:AB_1845897
Product name
Anti-CDH17
Provider product page
Atlas Antibodies - HPA026556
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GTKVGNVTAKDPEGLDISYSLRGDTRGWLKIDHVT
GEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVS
EFHLILMDVNDNPPRLAKDYT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -