Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001015-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001015-M01, RRID:AB_489831
- Product name
- CDH17 monoclonal antibody (M01), clone 1H3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CDH17.
- Antigen sequence
EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAV
TFELTGETDNIFVIEREGLLYYNRALDRETRSTHN
LQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQ
SKY- Isotype
- IgG
- Antibody clone number
- 1H3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Comparison of cadherin-17 expression between primary colorectal adenocarcinomas and their corresponding metastases: the possibility of a diagnostic marker for detecting the primary site of metastatic tumour.
Cadherin-17 is a useful diagnostic marker for adenocarcinomas of the digestive system.
Park JH, Seol JA, Choi HJ, Roh YH, Choi PJ, Lee KE, Roh MS
Histopathology 2011 Jan;58(2):315-8
Histopathology 2011 Jan;58(2):315-8
Cadherin-17 is a useful diagnostic marker for adenocarcinomas of the digestive system.
Su MC, Yuan RH, Lin CY, Jeng YM
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2008 Nov;21(11):1379-86
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2008 Nov;21(11):1379-86
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CDH17 monoclonal antibody (M01), clone 1H3. Western Blot analysis of CDH17 expression in human intestinal wall.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CDH17 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CDH17 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol