HPA026556

CDH17 antibody from Sigma-Aldrich
cadherin, HPT-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026556
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026556, RRID:AB_1845897
Product name
Anti-CDH17 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026556
Antibody type
Polyclonal
Antigen
Cadherin-17 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTKVGNVTAKDPEGLDISYSLRGDTRGWLKIDHVT
GEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVS
EFHLILMDVNDNPPRLAKDYT
Storage
-20C
Provider Type Product Number
- No reagents -