HPA003897

EPS8 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003897
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003897, RRID:AB_1848224
Product name
Anti-EPS8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003897
Antibody type
Polyclonal
Antigen
Epidermal growth factor receptor kinase substrate 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQ
LAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADG
YAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNY
EPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEI
LDD
Storage
-20C
Provider Type Product Number
- No reagents -