ABIN630194

antibody from antibodies-online

Targeting: MCM7 CDC47, MCM2, PPP1R104

Western blot

Antibody data

Submit

Validation data

Product number: ABIN630194 - Provider product page
Provider: antibodies-online
Product name: anti-Minichromosome Maintenance Complex Component 7 (MCM7) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: MCM7 antibody was raised using the middle region of MCM7 corresponding to a region with amino acids GGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV
Description: Purified
Reactivity: Human, Mouse, Rat, Canine
Host: Rabbit
Epitope: Middle Region
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

MCM7 protein structure - ABIN630194 shown in red.