HPA003898

MCM7 antibody from Sigma-Aldrich
CDC47, MCM2, PPP1R104
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003898
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003898, RRID:AB_1853632
Product name
Anti-MCM7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003898
Antibody type
Polyclonal
Antigen
DNA replication licensing factor MCM7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFI
KFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIA
QPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEA
HRIVKMNKSEDDESGAGE
Storage
-20C
Provider Type Product Number
- No reagents -