HPA027524
antibody from Atlas Antibodies
Targeting: ZEB1
AREB6, BZP, FECD6, NIL-2-A, PPCD3, TCF8, ZEB, Zfhep, Zfhx1a
Antibody data
- Antibody Data
- Antigen structure
- References [18]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA027524 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA027524, RRID:AB_1844977
- Product name
- Anti-ZEB1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAY
YALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQA
GQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANE
PQDSTVNLQSPLKMTNSPVLPVGST- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references EMT-associated factors promote invasive properties of uveal melanoma cells.
SPROUTY-2 represses the epithelial phenotype of colon carcinoma cells via upregulation of ZEB1 mediated by ETS1 and miR-200/miR-150
ZEB1-associated drug resistance in cancer cells is reversed by the class I HDAC inhibitor mocetinostat.
The EMT-activator ZEB1 induces bone metastasis associated genes including BMP-inhibitors.
The clinical role of epithelial-mesenchymal transition and stem cell markers in advanced-stage ovarian serous carcinoma effusions
Stromal contribution to the colorectal cancer transcriptome
Epithelial-mesenchymal transition induces endoplasmic-reticulum-stress response in human colorectal tumor cells.
CD95 and CD95L promote and protect cancer stem cells.
Transcription factors OVOL1 and OVOL2 induce the mesenchymal to epithelial transition in human cancer.
Direct RNA sequencing mediated identification of mRNA localized in protrusions of human MDA-MB-231 metastatic breast cancer cells.
The microRNA-200 family targets multiple non-small cell lung cancer prognostic markers in H1299 cells and BEAS-2B cells
Epithelial to Mesenchymal Transition in Murine Tracheal Allotransplantation: An Immunohistochemical Observation
Zeb1 Regulates E-cadherin and Epcam (Epithelial Cell Adhesion Molecule) Expression to Control Cell Behavior in Early Zebrafish Development
Activation of miR200 by c-Myb depends on ZEB1 expression and miR200 promoter methylation.
Dual roles of the transcription factor grainyhead-like 2 (GRHL2) in breast cancer.
Poor-prognosis colon cancer is defined by a molecularly distinct subtype and develops from serrated precursor lesions
Overexpression of ZEB1 associated with metastasis and invasion in patients with gastric carcinoma
Quantitative analysis of microRNAs in tissue microarrays by in situ hybridization
Asnaghi L, Gezgin G, Tripathy A, Handa JT, Merbs SL, van der Velden PA, Jager MJ, Harbour JW, Eberhart CG
Molecular vision 2015;21:919-29
Molecular vision 2015;21:919-29
SPROUTY-2 represses the epithelial phenotype of colon carcinoma cells via upregulation of ZEB1 mediated by ETS1 and miR-200/miR-150
Barbáchano A, Fernández-Barral A, Pereira F, Segura M, Ordóñez-Morán P, Carrillo-de Santa Pau E, González-Sancho J, Hanniford D, Martínez N, Costales-Carrera A, Real F, Pálmer H, Rojas J, Hernando E, Muñoz A
Oncogene 2015 October
Oncogene 2015 October
ZEB1-associated drug resistance in cancer cells is reversed by the class I HDAC inhibitor mocetinostat.
Meidhof S, Brabletz S, Lehmann W, Preca BT, Mock K, Ruh M, Schüler J, Berthold M, Weber A, Burk U, Lübbert M, Puhr M, Culig Z, Wellner U, Keck T, Bronsert P, Küsters S, Hopt UT, Stemmler MP, Brabletz T
EMBO molecular medicine 2015 Jun;7(6):831-47
EMBO molecular medicine 2015 Jun;7(6):831-47
The EMT-activator ZEB1 induces bone metastasis associated genes including BMP-inhibitors.
Mock K, Preca BT, Brummer T, Brabletz S, Stemmler MP, Brabletz T
Oncotarget 2015 Jun 10;6(16):14399-412
Oncotarget 2015 Jun 10;6(16):14399-412
The clinical role of epithelial-mesenchymal transition and stem cell markers in advanced-stage ovarian serous carcinoma effusions
Davidson B, Holth A, Hellesylt E, Tan T, Huang R, Tropé C, Nesland J, Thiery J
Human Pathology 2015 January;46(1):1-8
Human Pathology 2015 January;46(1):1-8
Stromal contribution to the colorectal cancer transcriptome
Isella C, Terrasi A, Bellomo S, Petti C, Galatola G, Muratore A, Mellano A, Senetta R, Cassenti A, Sonetto C, Inghirami G, Trusolino L, Fekete Z, De Ridder M, Cassoni P, Storme G, Bertotti A, Medico E
Nature Genetics 2015 February;47(4):312-319
Nature Genetics 2015 February;47(4):312-319
Epithelial-mesenchymal transition induces endoplasmic-reticulum-stress response in human colorectal tumor cells.
Zeindl-Eberhart E, Brandl L, Liebmann S, Ormanns S, Scheel SK, Brabletz T, Kirchner T, Jung A
PloS one 2014;9(1):e87386
PloS one 2014;9(1):e87386
CD95 and CD95L promote and protect cancer stem cells.
Ceppi P, Hadji A, Kohlhapp FJ, Pattanayak A, Hau A, Liu X, Liu H, Murmann AE, Peter ME
Nature communications 2014 Nov 4;5:5238
Nature communications 2014 Nov 4;5:5238
Transcription factors OVOL1 and OVOL2 induce the mesenchymal to epithelial transition in human cancer.
Roca H, Hernandez J, Weidner S, McEachin RC, Fuller D, Sud S, Schumann T, Wilkinson JE, Zaslavsky A, Li H, Maher CA, Daignault-Newton S, Healy PN, Pienta KJ
PloS one 2013;8(10):e76773
PloS one 2013;8(10):e76773
Direct RNA sequencing mediated identification of mRNA localized in protrusions of human MDA-MB-231 metastatic breast cancer cells.
Jakobsen KR, Sørensen E, Brøndum KK, Daugaard TF, Thomsen R, Nielsen AL
Journal of molecular signaling 2013 Sep 1;8(1):9
Journal of molecular signaling 2013 Sep 1;8(1):9
The microRNA-200 family targets multiple non-small cell lung cancer prognostic markers in H1299 cells and BEAS-2B cells
Ivanov A
International Journal of Oncology 2013 May
International Journal of Oncology 2013 May
Epithelial to Mesenchymal Transition in Murine Tracheal Allotransplantation: An Immunohistochemical Observation
Konoeda C, Koinuma D, Morishita Y, Sano A, Nagayama K, Motomura N, Kakimi K, Miyazono K, Nakajima J, Nicolls M, Murakawa T
Transplantation Proceedings 2013 June;45(5):1797-1801
Transplantation Proceedings 2013 June;45(5):1797-1801
Zeb1 Regulates E-cadherin and Epcam (Epithelial Cell Adhesion Molecule) Expression to Control Cell Behavior in Early Zebrafish Development
Vannier C, Mock K, Brabletz T, Driever W
Journal of Biological Chemistry 2013 June;288(26):18643-18659
Journal of Biological Chemistry 2013 June;288(26):18643-18659
Activation of miR200 by c-Myb depends on ZEB1 expression and miR200 promoter methylation.
Pieraccioli M, Imbastari F, Antonov A, Melino G, Raschellà G
Cell cycle (Georgetown, Tex.) 2013 Jul 15;12(14):2309-20
Cell cycle (Georgetown, Tex.) 2013 Jul 15;12(14):2309-20
Dual roles of the transcription factor grainyhead-like 2 (GRHL2) in breast cancer.
Werner S, Frey S, Riethdorf S, Schulze C, Alawi M, Kling L, Vafaizadeh V, Sauter G, Terracciano L, Schumacher U, Pantel K, Assmann V
The Journal of biological chemistry 2013 Aug 9;288(32):22993-3008
The Journal of biological chemistry 2013 Aug 9;288(32):22993-3008
Poor-prognosis colon cancer is defined by a molecularly distinct subtype and develops from serrated precursor lesions
De Sousa E Melo F, Wang X, Jansen M, Fessler E, Trinh A, de Rooij L, de Jong J, de Boer O, van Leersum R, Bijlsma M, Rodermond H, van der Heijden M, van Noesel C, Tuynman J, Dekker E, Markowetz F, Medema J, Vermeulen L
Nature Medicine 2013 April;19(5):614-618
Nature Medicine 2013 April;19(5):614-618
Overexpression of ZEB1 associated with metastasis and invasion in patients with gastric carcinoma
Jia B, Liu H, Kong Q, Li B
Molecular and Cellular Biochemistry 2012 July;366(1-2):223-229
Molecular and Cellular Biochemistry 2012 July;366(1-2):223-229
Quantitative analysis of microRNAs in tissue microarrays by in situ hybridization
Hanna J, Wimberly H, Kumar S, Slack F, Agarwal S, Rimm D
BioTechniques 2012 April;52(4)
BioTechniques 2012 April;52(4)
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA027524 antibody. Corresponding ZEB1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human glioma shows strong nuclear positivity in tumor cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in glial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows strong nuclear positivity in stromal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human smooth muscle shows strong nuclear positivity in myocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no nuclear positivity in hepatocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong nuclear positivity in smooth muscle cells.
- Sample type
- HUMAN