HPA027524

ZEB1 antibody from Atlas Antibodies
AREB6, BZP, FECD6, NIL-2-A, PPCD3, TCF8, ZEB, Zfhep, Zfhx1a
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027524
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027524, RRID:AB_1844977
Product name
Anti-ZEB1
Provider product page
Atlas Antibodies - HPA027524
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAY
YALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQA
GQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANE
PQDSTVNLQSPLKMTNSPVLPVGST
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -