HPA027524

ZEB1 antibody from Sigma-Aldrich
AREB6, BZP, FECD6, NIL-2-A, PPCD3, TCF8, ZEB, Zfhep, Zfhx1a
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027524
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027524, RRID:AB_1844977
Product name
Anti-ZEB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027524
Antibody type
Polyclonal
Antigen
Zinc finger E-box-binding homeobox 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAY
YALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQA
GQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANE
PQDSTVNLQSPLKMTNSPVLPVGST
Storage
-20C
Provider Type Product Number
- No reagents -