HPA003894

BIN1 antibody from Sigma-Aldrich
AMPH2, AMPHL, SH3P9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003894
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003894, RRID:AB_1845360
Product name
Anti-BIN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003894
Antibody type
Polyclonal
Antigen
Myc box-dependent-interacting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFM
FKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEE
QDEGWLMGVKESDWNQHKELEKCRGVFPENFTERV
P
Storage
-20C
Provider Type Product Number
- No reagents -