HPA019259

NME8 antibody from Sigma-Aldrich
CILD6, NM23-H8, SPTRX2, TXNDC3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019259
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019259, RRID:AB_1858475
Product name
Anti-TXNDC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019259
Antibody type
Polyclonal
Antigen
Thioredoxin domain-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQLCDIEEDAANVAKFMDAFFPDFKKMKSMKLEKT
LALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVL
SEKEAQALCKEYENED
Storage
-20C
Provider Type Product Number
- No reagents -