HPA019259

NME8 antibody from Atlas Antibodies
CILD6, NM23-H8, SPTRX2, TXNDC3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019259
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019259, RRID:AB_1858475
Product name
Anti-NME8
Provider product page
Atlas Antibodies - HPA019259
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AQLCDIEEDAANVAKFMDAFFPDFKKMKSMKLEKT
LALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVL
SEKEAQALCKEYENED
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -