HPA019535

ELAC2 antibody from Atlas Antibodies
FLJ10530, HPC2
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA019535
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019535, RRID:AB_1848106
Product name
Anti-ELAC2
Provider product page
Atlas Antibodies - HPA019535
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WMERFGPDTQHLVLNENCASVHNLRSHKIQTQLNL
IHPDIFPLLTSFRCKKEGPTLSVPMVQGECLLKYQ
LRPRREWQRDAIITCNPEEFIVEALQLPNFQQSVQ
EYR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -