Antibody data
- Product number
- HPA019535
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA019535, RRID:AB_1848106
- Product name
- Anti-ELAC2
- Provider product page
- Atlas Antibodies - HPA019535
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
WMERFGPDTQHLVLNENCASVHNLRSHKIQTQLNL
IHPDIFPLLTSFRCKKEGPTLSVPMVQGECLLKYQ
LRPRREWQRDAIITCNPEEFIVEALQLPNFQQSVQ
EYR
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
55af80e3e0991
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Confocal images of immunofluorescently stained human U-2 OS cells.The protein ELAC2 is shown in green. The image to the left show cells transfected with control siRNA and the image to the right show cells where ELAC2 has been downregulated with specific siRNA.
- Sample type
- U-2 OS cells
- Primary Ab dilution
- 1:49
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:800
- Knockdown/Genetic Approaches Application
- Immunocytochemistry
- KD Reagent Type
- siRNA
- Downregulation
- >50%
- KD Reagent Provider
- Thermo Fisher Scientific
- KD Reagent Prod no
- s34125
- KD Reagent Prod page
- KD Reagent Prod page
- KD Reagent Prod no 2
- s34124
- KD Reagent Page 2
- KD Reagent Page 2
- KD Reagent Prod no 3
- s34123
- KD Reagent Page 3
- KD Reagent Page 3
- Antibody Lot Number
- R08450
- Appendix
- 55b096503c7c3.pdf
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human oral mucosa shows strong nucleolar positivity in squamous epithelial cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong positivity in nucleoli in squamous epithelial cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows weak to moderate nuclear positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong nuclear and nucleolar positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
Explore
Validate
Learn
Supportive data in Antibodypedia
Enhanced validation
