Antibody data

Product number
H00008880-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008880-M03, RRID:AB_1136936
Product name
FUBP1 monoclonal antibody (M03), clone 1E10
Provider product page
Abnova Corporation - H00008880-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant FUBP1.
Antigen sequence
MADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDAL
QRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDG
DQPDAKKVAPQNDSFGTQLPPMHQQQRSVMTEEYK
VPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSG
GLPERSCMLTGTPESVQSAKRLLDQIVEKGRPAPG
FHHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQL
QERAGVKMVMIQDGPQNTGADKPLRITGDPYKVQQ
AKEMVLELIRDQGGFREVRNEYGSRIGGNEGIDVP
IPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDG
TTPERIAQITGPPDRCQHAAEIITDLLRSVQAGNP
GGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTG
KTGLIIGKGGETIKSISQQSGARIELQRNPPPNAD
PNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGP
PVPHGPHGVPGPHGPPGPPGPGTPMGPYNPAPYNP
GPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDPA
KAGTDPNSAAWAAYYAHYYQQQAQPPPAAPAGAPT
TTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQA
VPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTSP
QGMPQHPPAPQCRFDPASIELAL
Isotype
IgG
Antibody clone number
1E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -