HPA006149

FBP, FUBP

Validated within the Antibodypedia Validation Initative

Antibody data

Submit

Validation data

Product number: HPA006149
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA006149, RRID:AB_1234371
Product name: Anti-FUBP1
Provider product page: Atlas Antibodies - HPA006149
Antibody type: Polyclonal
Description: Affinity purified using the PrEST antigen as affinity ligand
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSND YGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPM HQQQRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQ ESGCKIQIAPDSGGLPERSCML
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.

Provider	Type	Product Number
- No reagents -

Supportive validation

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Sample type: MOUSE, RAT

Enhanced validation

Submitted by: klas2
Enhanced method: Genetic validation
Main image
Experimental details: Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting FUBP1 or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting FUBP1 Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
Sample type: U-2 OS
Primary Ab dilution: 1:58
Conjugate: Horseradish Peroxidase
Secondary Ab: Secondary Ab
Secondary Ab dilution: 1:3000
Knockdown/Genetic Approaches Application: Western blot
KD Reagent Type: siRNA
Downregulation: >75%
KD Reagent Provider: Thermo Fisher Scientific
KD Reagent Prod no: s16966
KD Reagent Prod page: KD Reagent Prod page
KD Reagent Prod no 2: s16967
KD Reagent Page 2: KD Reagent Page 2
KD Reagent Prod no 3: s16968
KD Reagent Page 3: KD Reagent Page 3
Antibody Lot Number: R07601
Appendix: 56601f94b41fe.pdf