Antibody data
- Product number
- HPA006149
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006149, RRID:AB_1849172
- Product name
- Anti-FUBP1
- Provider product page
- Atlas Antibodies - HPA006149
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSND
YGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPM
HQQQRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQ
ESGCKIQIAPDSGGLPERSCML
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in human cell line SH-SY5Y.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Enhanced validation
- Submitted by
-
klas2
- Enhanced method
- Genetic validation
- Main image

- Experimental details
- Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting FUBP1 or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting FUBP1 Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
- Sample type
- U-2 OS
- Primary Ab dilution
- 1:58
- Conjugate
- Horseradish Peroxidase
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:3000
- Knockdown/Genetic Approaches Application
- Western blot
- KD Reagent Type
- siRNA
- Downregulation
- >75%
- KD Reagent Prod page
- KD Reagent Prod page
- KD Reagent Prod no
- s16966
- KD Reagent Provider
- Thermo Fisher Scientific
- KD Reagent Prod no 2
- s16967
- KD Reagent Page 2
- KD Reagent Page 2
- KD Reagent Prod no 3
- s16968
- KD Reagent Page 3
- KD Reagent Page 3
- Antibody Lot Number
- R07601
- Appendix
- 56601f94b41fe.pdf
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image

- Experimental details
- Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1, using Anti-FUBP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human lymph node shows strong nuclear positivity in germinal center cells and non-germinal center cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human endometrium shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human endometrium shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle shows strong nuclear positivity in myocytes.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human lymph node shows strong nuclear positivity in germinal center cells.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human endometrium and liver tissues using Anti-FUBP1 antibody. Corresponding FUBP1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using HPA006149 antibody. Corresponding FUBP1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more