HPA006149

FUBP1 antibody from Atlas Antibodies
FBP, FUBP
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA006149
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006149, RRID:AB_1234371
Product name
Anti-FUBP1
Provider product page
Atlas Antibodies - HPA006149
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSND
YGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPM
HQQQRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQ
ESGCKIQIAPDSGGLPERSCML
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -