HPA026598

API5 antibody from Atlas Antibodies
AAC-11, AAC11, API5L1
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA026598
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026598, RRID:AB_1844927
Product name
Anti-API5
Provider product page
Atlas Antibodies - HPA026598
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TVEELYRNYGILADATEQVGQHKDAYQVILDGVKG
GTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCE
DEDVSIRRQAIKELPQFATGENLPRVADILTQLLQ
TDDSAEFNLVN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -