HPA002875

SIPA1L1 antibody from Atlas Antibodies
E6TP1, KIAA0440
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002875
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002875, RRID:AB_611787
Product name
Anti-SIPA1L1
Provider product page
Atlas Antibodies - HPA002875
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IRQRSNSDITISELDVDSFDECISPTYKTGPSLHR
EYGSTSSIDKQGTSGESFFDLLKGYKDDKSDRGPT
PTKLSDFLITGGGKGSGFSLDVIDGPISQRENLRL
FKEREKPLKRRSKSETGDSSIFRKLRNAKGEELGK
SSDLEDNRSE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -