HPA002875

SIPA1L1 antibody from Atlas Antibodies
E6TP1, KIAA0440, SPAR1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002875
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002875, RRID:AB_1079974
Product name
Anti-SIPA1L1
Provider product page
Atlas Antibodies - HPA002875
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IRQRSNSDITISELDVDSFDECISPTYKTGPSLHR
EYGSTSSIDKQGTSGESFFDLLKGYKDDKSDRGPT
PTKLSDFLITGGGKGSGFSLDVIDGPISQRENLRL
FKEREKPLKRRSKSETGDSSIFRKLRNAKGEELGK
SSDLEDNRSE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -