HPA002875

SIPA1L1 antibody from Sigma-Aldrich
E6TP1, KIAA0440
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002875
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002875, RRID:AB_1079974
Product name
Anti-SIPA1L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002875
Antibody type
Polyclonal
Antigen
Signal-induced proliferation-associated 1-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IRQRSNSDITISELDVDSFDECISPTYKTGPSLHR
EYGSTSSIDKQGTSGESFFDLLKGYKDDKSDRGPT
PTKLSDFLITGGGKGSGFSLDVIDGPISQRENLRL
FKEREKPLKRRSKSETGDSSIFRKLRNAKGEELGK
SSDLEDNRSE
Storage
-20C
Provider Type Product Number
- No reagents -